COQ10B Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A15193
Artikelname: COQ10B Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A15193
Hersteller Artikelnummer: A15193
Alternativnummer: ABB-A15193-100UL,ABB-A15193-20UL,ABB-A15193-1000UL,ABB-A15193-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: COQ10B
Predicted to enable ubiquinone binding activity. Predicted to be involved in cellular respiration and ubiquinone biosynthetic process. Predicted to be located in mitochondrial inner membrane. Predicted to be active in mitochondrion.
Klonalität: Polyclonal
Molekulargewicht: 27kDa
NCBI: 80219
UniProt: Q9H8M1
Reinheit: Affinity purification
Sequenz: ASCGILMSRTLPLHTSILPKEICARTFFKITAPLINKRKEYSERRILGYSMQEMYDVVSGVEDYKHFVPWCKKSDVISKRSGYCKTRLEIGFPPVLERYTSVVTLVKPHLVKA
Target-Kategorie: COQ10B
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Cell Biology Developmental Biology,Endocrine Metabolism,Mitochondrial metabolism,Mitochondrial markers,Neuroscience,Neurodegenerative Diseases,Amyloid Plaque and Neurofibrillary Tangle Formation in Alzheimers Disease,Dopamine Signaling in Parkinsons Disease. Shipping: Ice Bag
Western blot analysis of various lysates using COQ10B Rabbit pAb (A15193) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.