CMKLR1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A15237
Artikelname: CMKLR1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A15237
Hersteller Artikelnummer: A15237
Alternativnummer: ABB-A15237-100UL,ABB-A15237-20UL,ABB-A15237-1000UL,ABB-A15237-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: DEZ, ERV1, RVER1, ChemR23, CHEMERINR, CMKLR1
Enables adipokinetic hormone binding activity and adipokinetic hormone receptor activity. Involved in several processes, including negative regulation of NF-kappaB transcription factor activity, positive regulation of macrophage chemotaxis, and regulation of calcium-mediated signaling. Located in plasma membrane.
Klonalität: Polyclonal
Molekulargewicht: 42kDa
NCBI: 1240
UniProt: Q99788
Reinheit: Affinity purification
Sequenz: NRLAKTKKPFKIIVTIIITFFLCWCPYHTLNLLELHHTAMPGSVFSLGLPLATALAIANSCMNPILYVFMGQDFKKFKVALFSRLVNALSEDTGHSSYPSH
Target-Kategorie: CMKLR1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. ResearchArea: Signal Transduction,G protein signaling,G-Protein-Coupled ReceptorsGPCR,Cell Biology Developmental Biology,Cytoskeleton,Extracellular Matrix,Bone. Shipping: Ice Bag
Western blot analysis of various lysates using CMKLR1 Rabbit pAb (A15237) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.