EPRS Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A15245
Artikelname: EPRS Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A15245
Hersteller Artikelnummer: A15245
Alternativnummer: ABB-A15245-20UL,ABB-A15245-100UL,ABB-A15245-1000UL,ABB-A15245-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: EARS, EPRS, PARS, QARS, QPRS, HLD15, PIG32, GLUPRORS
Aminoacyl-tRNA synthetases are a class of enzymes that charge tRNAs with their cognate amino acids. The protein encoded by this gene is a multifunctional aminoacyl-tRNA synthetase that catalyzes the aminoacylation of glutamic acid and proline tRNA species. Alternative splicing has been observed for this gene, but the full-length nature and biological validity of the variant have not been determined.
Klonalität: Polyclonal
Molekulargewicht: 171kDa
NCBI: 2058
UniProt: P07814
Reinheit: Affinity purification
Sequenz: EAKVLFDKVASQGEVVRKLKTEKAPKDQVDIAVQELLQLKAQYKSLIGVEYKPVSATGAEDKDKKKKEKENKSEKQNKPQKQNDGQRKDPSKNQGGGLSSS
Target-Kategorie: EPRS1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling. Shipping: Ice Bag
Western blot analysis of various lysates using EPRS Rabbit pAb (A15245) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.