SASH1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A15248
- Bilder (1)
| Artikelname: | SASH1 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A15248 |
| Hersteller Artikelnummer: | A15248 |
| Alternativnummer: | ABB-A15248-100UL,ABB-A15248-20UL,ABB-A15248-1000UL,ABB-A15248-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | DUH, DUH1, CAPOK, SH3D6A, dJ323M4.1, SASH1 |
| This gene encodes a scaffold protein involved in the TLR4 signaling pathway that may stimulate cytokine production and endothelial cell migration in response to invading pathogens. The encoded protein has also been described as a potential tumor suppressor that may negatively regulate proliferation, apoptosis, and invasion of cancer cells, and reduced expression of this gene has been observed in multiple human cancers. Mutations in this gene may be associated with abnormal skin pigmentation in human patients. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 137kDa |
| NCBI: | 23328 |
| UniProt: | O94885 |
| Reinheit: | Affinity purification |
| Sequenz: | MEDAGAAGPGPEPEPEPEPEPEPAPEPEPEPKPGAGTSEAFSRLWTDVMGILDGSLGNIDDLAQQYADYYNTCFSDVCERMEELRKRRVSQDLEVEKPDASPTSLQLRSQIEESLGFCSAVSTPEVERKNPLHKSNSEDSSVGKGDWKKKNKYFWQNFRKNQKGIMRQTSKGEDVGYVASEITMSDEERIQLMMMVKEKMITIEEALARLKEYEAQHRQSAALDPADWPDGSYPTFDGSSNCNSREQSDDETEES |
| Target-Kategorie: | SASH1 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse. ResearchArea: Cancer,Tumor suppressors. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using SASH1 Rabbit pAb (A15248) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 5s. |
Produktgarantie und fachkundiger Support
