BTF3 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A15259
Artikelname: BTF3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A15259
Hersteller Artikelnummer: A15259
Alternativnummer: ABB-A15259-20UL,ABB-A15259-100UL,ABB-A15259-500UL,ABB-A15259-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: NACB, BTF3a, BTF3b, BETA-NAC, BTF3
This gene encodes the basic transcription factor 3. This protein forms a stable complex with RNA polymerase IIB and is required for transcriptional initiation. Alternative splicing results in multiple transcript variants encoding different isoforms. This gene has multiple pseudogenes.
Klonalität: Polyclonal
Molekulargewicht: 22kDa
NCBI: 689
UniProt: P20290
Reinheit: Affinity purification
Sequenz: KLGVNNISGIEEVNMFTNQGTVIHFNNPKVQASLAANTFTITGHAETKQLTEMLPSILNQLGADSLTSLRRLAEALPKQSVDGKAPLATGEDDDDEVPDLV
Target-Kategorie: BTF3
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,RNA Binding. Shipping: Ice Bag
Western blot analysis of various lysates, using BTF3 Rabbit pAb (A15259) at 1:900 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.