MYF6 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A15291
Artikelname: MYF6 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A15291
Hersteller Artikelnummer: A15291
Alternativnummer: ABB-A15291-20UL,ABB-A15291-100UL,ABB-A15291-500UL,ABB-A15291-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: CNM3, MRF4, myf-6, bHLHc4, MYF6
The protein encoded by this gene is a probable basic helix-loop-helix (bHLH) DNA binding protein involved in muscle differentiation. The encoded protein likely acts as a heterodimer with another bHLH protein. Defects in this gene are a cause of autosomal dominant centronuclear myopathy (ADCNM).
Klonalität: Polyclonal
Molekulargewicht: 27kDa
NCBI: 4618
UniProt: P23409
Reinheit: Affinity purification
Sequenz: WACKTCKRKSAPTDRRKAATLRERRRLKKINEAFEALKRRTVANPNQRLPKVEILRSAISYIERLQDLLHRLDQQEKMQELGVDPFSYRPKQENLEGADFL
Target-Kategorie: MYF6
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:200 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Stem Cells,Mesenchymal Stem Cells. Shipping: Ice Bag
Western blot analysis of lysates from wild type (WT) and 293T cells transfected with MYF6 using MYF6 Rabbit pAb (A15291) at 1:2000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.