OXT Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A15296
Artikelname: OXT Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A15296
Hersteller Artikelnummer: A15296
Alternativnummer: ABB-A15296-20UL,ABB-A15296-100UL,ABB-A15296-1000UL,ABB-A15296-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: OT, OT-NPI, OXT-NPI, OXT
This gene encodes a precursor protein that is processed to produce oxytocin and neurophysin I. Oxytocin is a posterior pituitary hormone which is synthesized as an inactive precursor in the hypothalamus along with its carrier protein neurophysin I. Together with neurophysin, it is packaged into neurosecretory vesicles and transported axonally to the nerve endings in the neurohypophysis, where it is either stored or secreted into the bloodstream. The precursor seems to be activated while it is being transported along the axon to the posterior pituitary. This hormone contracts smooth muscle during parturition and lactation. It is also involved in cognition, tolerance, adaptation and complex sexual and maternal behaviour, as well as in the regulation of water excretion and cardiovascular functions.
Klonalität: Polyclonal
Molekulargewicht: 13kDa
NCBI: 5020
UniProt: P01178
Reinheit: Affinity purification
Sequenz: MAGPSLACCLLGLLALTSACYIQNCPLGGKRAAPDLDVRKCLPCGPGGKGRCFGPNICCAEELGCFVGTAEALRCQEENYLPSPCQSGQKACGSGGRCAVLGLCCSPDGCHADPACDAEATFSQR
Target-Kategorie: OXT
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:200 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Neuroscience. Shipping: Ice Bag
Western blot analysis of various lysates using OXT Rabbit pAb (A15296) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.