LEFTY1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A15389
- Bilder (1)
| Artikelname: | LEFTY1 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A15389 |
| Hersteller Artikelnummer: | A15389 |
| Alternativnummer: | ABB-A15389-20UL,ABB-A15389-100UL,ABB-A15389-1000UL,ABB-A15389-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | LEFTB, LEFTYB, LEFTY1 |
| This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate the mature protein, which plays a role in left-right asymmetry determination of organ systems during development. This gene is closely linked to both a related family member and a related pseudogene. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 41kDa |
| NCBI: | 10637 |
| UniProt: | O75610 |
| Reinheit: | Affinity purification |
| Sequenz: | RFSQSFREVAGRFLALEASTHLLVFGMEQRLPPNSELVQAVLRLFQEPVPKAALHRHGRLSPRSARARVTVEWLRVRDDGSNRTSLIDSRLVSVHESGWKAFDVTEAVNFWQQLSRPRQPLLLQVSVQREHLGPLASGAHKLVRFASQGAPAGLGEPQLELHTLDLGDYGAQGDCDPEAPMTEGTRCCRQEMYIDLQGMKWAENWVLEPPGFLAYECVGTCRQPPEALAFKWPFLGPRQCIASETDSLPMIVSIK |
| Target-Kategorie: | LEFTY1 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:200 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse. ResearchArea: Cell Biology Developmental Biology,Growth factors,Immunology Inflammation,Cytokines,Stem Cells. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using LEFTY1 Rabbit pAb (A15389) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 1s. |
Produktgarantie und fachkundiger Support
