MGAT4A Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A15401
Artikelname: MGAT4A Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A15401
Hersteller Artikelnummer: A15401
Alternativnummer: ABB-A15401-20UL,ABB-A15401-100UL,ABB-A15401-1000UL,ABB-A15401-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: GNT-IV, GnT-4a, GNT-IVA, MGAT4A
This gene encodes a key glycosyltransferase that regulates the formation of tri- and multiantennary branching structures in the Golgi apparatus. The encoded protein, in addition to the related isoenzyme B, catalyzes the transfer of N-acetylglucosamine (GlcNAc) from UDP-GlcNAc in a beta-1,4 linkage to the Man-alpha-1,3-Man-beta-1,4-GlcNAc arm of R-Man-alpha-1,6(GlcNAc-beta-1,2-Man-alpha-1,3)Man-beta-1,4-GlcNAc-beta-1,4-GlcNAc-beta-1-Asn. The encoded protein may play a role in regulating the availability of serum glycoproteins, oncogenesis, and differentiation.
Klonalität: Polyclonal
Molekulargewicht: 62kDa
NCBI: 11320
UniProt: Q9UM21
Reinheit: Affinity purification
Sequenz: QNGKEKLIAYQREFLALKERLRIAEHRISQRSSELNTIVQQFKRVGAETNGSKDALNKFSDNTLKLLKELTSK
Target-Kategorie: MGAT4A
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:200 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human. ResearchArea: Signal Transduction,Endocrine Metabolism,Carbohydrate metabolism,Endocrine and metabolic diseases,Diabetes. Shipping: Ice Bag
Western blot analysis of various lysates using MGAT4A Rabbit pAb (A15401) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.