SLC44A1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A15413
- Bilder (1)
| Artikelname: | SLC44A1 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A15413 |
| Hersteller Artikelnummer: | A15413 |
| Alternativnummer: | ABB-A15413-100UL,ABB-A15413-20UL,ABB-A15413-500UL,ABB-A15413-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CD92, CTL1, CDW92, CHTL1, CONATOC, SLC44A1 |
| Enables choline transmembrane transporter activity. Involved in choline transport and transmembrane transport. Located in several cellular components, including cytosol, mitochondrion, and nucleoplasm. Implicated in high grade glioma. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 73kDa |
| NCBI: | 23446 |
| UniProt: | Q8WWI5 |
| Reinheit: | Affinity purification |
| Sequenz: | AARLVSGYDSYGNICGQKNTKLEAIPNSGMDHTQRKYVFFLDPCNLDLINRKIKSVALCVAACPRQELKTLSDVQKFAEINGSALCSYNLKPSEYTTSPKSSVLCPKLPVPASAPIPFFHRCAPVNISCYAKFAEALITFVSDNSVLHRLISGVMT |
| Target-Kategorie: | SLC44A1 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:200 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Immunology Inflammation,CDs. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using SLC44A1 Rabbit pAb (A15413) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 30s. |
Produktgarantie und fachkundiger Support
