MS4A7 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A15495
Artikelname: MS4A7 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A15495
Hersteller Artikelnummer: A15495
Alternativnummer: ABB-A15495-20UL,ABB-A15495-100UL,ABB-A15495-500UL,ABB-A15495-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: CFFM4, MS4A8, 4SPAN2, CD20L4, MS4A7
This gene encodes a member of the membrane-spanning 4A gene family, members of which are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns in hematopoietic cells and nonlymphoid tissues. This family member is associated with mature cellular function in the monocytic lineage, and it may be a component of a receptor complex involved in signal transduction. This gene is localized to 11q12, in a cluster of other family members. At least four alternatively spliced transcript variants encoding two distinct isoforms have been observed.
Klonalität: Polyclonal
Molekulargewicht: 26kDa
NCBI: 58475
UniProt: Q9GZW8
Reinheit: Affinity purification
Sequenz: SLSIISGKQSTKPFDLSSLTSNAVSSVTAGAGLFLLADSMVALRTASQHCGSEMDYLSSLPYSEYYYPIYEIKDCLLTSVSLTGVLVVMLIFTVLELLLAA
Target-Kategorie: MS4A7
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:200 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Mouse. ResearchArea: Cell Biology Developmental Biology. Shipping: Ice Bag
Western blot analysis of lysates from mouse spleen, using MS4A7 Rabbit pAb (A15495) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.