KCNH6 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A15522
- Bilder (1)
| Artikelname: | KCNH6 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A15522 |
| Hersteller Artikelnummer: | A15522 |
| Alternativnummer: | ABB-A15522-100UL,ABB-A15522-20UL,ABB-A15522-500UL,ABB-A15522-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | ERG2, ERG-2, HERG2, Kv11.2, hERG-2, KCNH6 |
| Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, subfamily H. This member is a pore-forming (alpha) subunit. Alternative splicing results in multiple transcript variants that encode different isoforms. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 110kDa |
| NCBI: | 81033 |
| UniProt: | Q9H252 |
| Reinheit: | Affinity purification |
| Sequenz: | TGPNTPSSAVSRLAQALLGAEECKVDILYYRKDASSFRCLVDVVPVKNEDGAVIMFILNFEDLAQLLAKCSSRSLSQRLLSQSFLGSEGSHGRPGGPGPGTGRGKYRTISQIPQFTLNFVEFNLEKHRSSSTTEIEIIAPHKVVERTQNVT |
| Target-Kategorie: | KCNH6 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:200 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human. ResearchArea: Neuroscience. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using KCNH6 Rabbit pAb (A15522) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit (RM00021). Exposure time: 60s. |
Produktgarantie und fachkundiger Support
