RTBDN Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A15525
- Bilder (1)
| Artikelname: | RTBDN Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A15525 |
| Hersteller Artikelnummer: | A15525 |
| Alternativnummer: | ABB-A15525-100UL,ABB-A15525-20UL,ABB-A15525-500UL,ABB-A15525-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | RTBDN, retbindin |
| This gene was first identified in a study of human eye tissues. The protein encoded by this gene is preferentially expressed in the retina and may play a role in binding retinoids and other carotenoids as it shares homology with riboflavin binding proteins. Alternative splicing results in multiple transcript variants and protein isoforms. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 25kDa |
| NCBI: | 83546 |
| UniProt: | Q9BSG5 |
| Reinheit: | Affinity purification |
| Sequenz: | SRPLQARSQQHHGLAADLGKGKLHLAGPCCPSEMDTTETSGPGNHPERCGVPSPECESFLEHLQRALRSRFRLRLLGVRQAQPLCEELCQAWFANCEDDITCGPTWLPLSEKRGCEPSCLTYGQTFADGTDLCRSALGHALPVAAPGARHCFNISISAVPRPRPGRRGREAPSRRSRSPRTSILDAAGSGSGSGSGSGP |
| Target-Kategorie: | RTBDN |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:200 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Rat. ResearchArea: Neuroscience. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from rat eye, using RTBDN Rabbit pAb (A15525) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 10s. |
Produktgarantie und fachkundiger Support
