GPRIN1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A15555
- Bilder (1)
| Artikelname: | GPRIN1 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A15555 |
| Hersteller Artikelnummer: | A15555 |
| Alternativnummer: | ABB-A15555-100UL,ABB-A15555-20UL,ABB-A15555-1000UL,ABB-A15555-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | GRIN1, GPRIN1 |
| Predicted to enable phosphoprotein binding activity. Predicted to be involved in neuron projection development. Predicted to be located in growth cone. Predicted to be active in plasma membrane. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 102kDa |
| NCBI: | 114787 |
| UniProt: | Q7Z2K8 |
| Reinheit: | Affinity purification |
| Sequenz: | MDTAEDPAWLQLLQKDSSPPGPRPTAFFCPQDGSLGAGSSAMRDYCPSQQKASPAPPRHTPDQSPGMESRHRSPSGAGEGASCSDGPRGSLACPSPTCFSPQESPSKETLEAHGASISGTPEATTSGKPEPVSSVKTEPKSSDDRNPMFLEKMDFKSSKQADSTSIGKEDPGSSRKADPMFTGKAEPEILGKGDPVAPGRMDPMTVRKEDLGSLGKVDPLCSSKTYTVSPRKEDPGSLRKVDPVSSDKVDPVFPR |
| Target-Kategorie: | GPRIN1 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:200 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Neuroscience, Cell Type Marker,Neuron marker. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using GPRIN1 Rabbit pAb (A15555) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 5s. |
Produktgarantie und fachkundiger Support
