SLC25A26 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A15557
Artikelname: SLC25A26 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A15557
Hersteller Artikelnummer: A15557
Alternativnummer: ABB-A15557-20UL,ABB-A15557-100UL,ABB-A15557-1000UL,ABB-A15557-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: SAMC, COXPD28, SLC25A26
This gene is a member of the mitochondrial carrier family which includes nuclear-encoded transporters localized on the inner mitochondrial membranes. Members of the family transport important small molecules across the mitochondrial inner membrane. This protein is involved in the transport of S-adenosylmethionine (SAM) into the mitochondria. Mutations in this gene are associated with combined oxidative phosphorylation deficiency 28. Alternative splicing results in multiple transcript variants encoding different isoforms.
Klonalität: Polyclonal
Molekulargewicht: 29kDa
NCBI: 115286
UniProt: Q70HW3
Reinheit: Affinity purification
Sequenz: IRVPSEVVKQRAQVSASTRTFQIFSNILYEEGIQGLYRGYKSTVLREIPFSLVQFPLWESLKALWSWRQDHVVDSWQSAVC
Target-Kategorie: SLC25A26
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:200 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Mouse. Shipping: Ice Bag
Western blot analysis of various lysates using SLC25A26 Rabbit pAb (A15557) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90S.