ADGRA3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A15573
- Bilder (1)
| Artikelname: | ADGRA3 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A15573 |
| Hersteller Artikelnummer: | A15573 |
| Alternativnummer: | ABB-A15573-100UL,ABB-A15573-20UL,ABB-A15573-1000UL,ABB-A15573-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | PGR21, TEM5L, GPR125, ADGRA3 |
| This gene encodes a member of the G protein-coupled receptor superfamily. This membrane protein may play a role in tumor angiogenesis through its interaction with the human homolog of the Drosophila disc large tumor suppressor gene. This gene is mapped to a candidate region of chromosome 4 which may be associated with bipolar disorder and schizophrenia. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 146kDa |
| NCBI: | 166647 |
| UniProt: | Q8IWK6 |
| Reinheit: | Affinity purification |
| Sequenz: | ITAYLQCTRNTHGSGIYPGNPQDERKAWRRCDRGGFWADDDYSRCQYANDVTRVLYMFNQMPLNLTNAVATARQLLAYTVEAANFSDKMDVIFVAEMIEKFGRFTKEEKSKELGDVMVDIASNIMLADERVLWLAQREAKACSRIVQCLQRIATYRLAGGAHVYSTYSPNIALEAYVIKSTGFTGMTCTVFQKVAASDRTGLSDYGRRDPEGNLDKQLSFKCNVSNTFSSL |
| Target-Kategorie: | ADGRA3 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:200 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Mouse,Rat. ResearchArea: G protein signaling,G-Protein-Coupled ReceptorsGPCR. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from Mouse liver, using ADGRA3 Rabbit pAb (A15573) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 3min. |
Produktgarantie und fachkundiger Support
