STT3B Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A15574
Artikelname: STT3B Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A15574
Hersteller Artikelnummer: A15574
Alternativnummer: ABB-A15574-100UL,ABB-A15574-20UL,ABB-A15574-500UL,ABB-A15574-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: SIMP, CDG1X, STT3-B, STT3B
The protein encoded by this gene is a catalytic subunit of a protein complex that transfers oligosaccharides onto asparagine residues. Defects in this gene are a cause of congenital disorder of glycosylation Ix (CDG1X).
Klonalität: Polyclonal
Molekulargewicht: 94kDa
NCBI: 201595
UniProt: Q8TCJ2
Reinheit: Affinity purification
Sequenz: MAEPSAPESKHKSSLNSSPWSGLMALGNSRHGHHGPGAQCAHKAAGGAAPPKPAPAGLSGGLSQPAGWQSLLSFTILFLAWLAGFSSRLFAVIRFESIIH
Target-Kategorie: STT3B
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. Shipping: Ice Bag
Western blot analysis of lysates from HUH-7 cells, using STT3B Rabbit pAb (A15574) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.