TBX5 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A15590
Artikelname: TBX5 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A15590
Hersteller Artikelnummer: A15590
Alternativnummer: ABB-A15590-20UL,ABB-A15590-100UL,ABB-A15590-500UL,ABB-A15590-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: HOS, TBX5
This gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. This gene is closely linked to related family member T-box 3 (ulnar mammary syndrome) on human chromosome 12. The encoded protein may play a role in heart development and specification of limb identity. Mutations in this gene have been associated with Holt-Oram syndrome, a developmental disorder affecting the heart and upper limbs. Several transcript variants encoding different isoforms have been described for this gene.
Klonalität: Polyclonal
Molekulargewicht: 58kDa
NCBI: 6910
UniProt: Q99593
Reinheit: Affinity purification
Sequenz: MADADEGFGLAHTPLEPDAKDLPCDSKPESALGAPSKSPSSPQAAFTQQGMEGIKVFLHERELWLKFHEV
Target-Kategorie: TBX5
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Cell Biology Developmental Biology,Apoptosis,Cardiovascular,Heart,Cardiogenesis. Shipping: Ice Bag
Western blot analysis of various lysates using TBX5 Rabbit pAb (A15590) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.