ETV6 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A15668
- Bilder (1)
| Artikelname: | ETV6 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A15668 |
| Hersteller Artikelnummer: | A15668 |
| Alternativnummer: | ABB-A15668-20UL,ABB-A15668-100UL,ABB-A15668-1000UL,ABB-A15668-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | TEL, THC5, TEL/ABL, ETV6 |
| This gene encodes an ETS family transcription factor. The product of this gene contains two functional domains: a N-terminal pointed (PNT) domain that is involved in protein-protein interactions with itself and other proteins, and a C-terminal DNA-binding domain. Gene knockout studies in mice suggest that it is required for hematopoiesis and maintenance of the developing vascular network. This gene is known to be involved in a large number of chromosomal rearrangements associated with leukemia and congenital fibrosarcoma. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 53kDa |
| NCBI: | 2120 |
| UniProt: | P41212 |
| Reinheit: | Affinity purification |
| Sequenz: | MSETPAQCSIKQERISYTPPESPVPSYASSTPLHVPVPRALRMEEDSIRLPAHLRLQPIYWSRDDVAQWLKWAENEFSLRPIDSNTFEMNGKALLLLTKEDFRYRSPHSGDVLYELLQHILKQRKPRILFSPFFHPGNSIHTQPEVILHQNHEEDNCVQRTPRPSVDNVHHNPPTIELLHRSRSPITTNHRPSPDPEQRPLRSPLDNMIRRLSPAERAQGPRPHQENNHQESYPLSVSPMENNHCPASSESHPKP |
| Target-Kategorie: | ETV6 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Cancer. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using ETV6 Rabbit pAb (A15668) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s. |
Produktgarantie und fachkundiger Support
