GLRA2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A15673
Artikelname: GLRA2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A15673
Hersteller Artikelnummer: A15673
Alternativnummer: ABB-A15673-20UL,ABB-A15673-100UL,ABB-A15673-1000UL,ABB-A15673-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: GLR, MRXSP, GLRA2
The glycine receptor consists of two subunits, alpha and beta, and acts as a pentamer. The protein encoded by this gene is an alpha subunit and can bind strychnine. Several transcript variants encoding different isoforms have been found for this gene.
Klonalität: Polyclonal
Molekulargewicht: 52kDa
NCBI: 2742
UniProt: P23416
Reinheit: Affinity purification
Sequenz: RLRRRQKRQNKEEDVTRESRFNFSGYGMGHCLQVKDGTAVKATPANPLPQPPKDGDAIKKKFVDRAKRIDT
Target-Kategorie: GLRA2
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Neuroscience. Shipping: Ice Bag
Western blot analysis of various lysates, using GLRA2 Rabbit pAb (A15673) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.