LETM1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A15685
- Bilder (1)
| Artikelname: | LETM1 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A15685 |
| Hersteller Artikelnummer: | A15685 |
| Alternativnummer: | ABB-A15685-100UL,ABB-A15685-20UL,ABB-A15685-1000UL,ABB-A15685-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | Mdm38, CONDMIM, SLC55A1, LETM1 |
| This gene encodes a protein that is localized to the inner mitochondrial membrane. The protein functions to maintain the mitochondrial tubular shapes and is required for normal mitochondrial morphology and cellular viability. Mutations in this gene cause Wolf-Hirschhorn syndrome, a complex malformation syndrome caused by the deletion of parts of the distal short arm of chromosome 4. Related pseudogenes have been identified on chromosomes 8, 15 and 19. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 83kDa |
| NCBI: | 3954 |
| UniProt: | O95202 |
| Reinheit: | Affinity purification |
| Sequenz: | MASILLRSCRGRAPARLPPPPRYTVPRGSPGDPAHLSCASTLGLRNCLNVPFGCCTPIHPVYTSSRGDHLGCWALRPECLRIVSRAPWTSTSVGFVAVGPQCLPVRGWHSSRPVRDDSVVEKSLKSLKDKNKKLEEGGPV |
| Target-Kategorie: | LETM1 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Endocrine Metabolism,Mitochondrial metabolism,Mitochondrial markers. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using LETM1 Rabbit pAb (A15685) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 30s. |
Produktgarantie und fachkundiger Support
