LTBP3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A15687
- Bilder (1)
| Artikelname: | LTBP3 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A15687 |
| Hersteller Artikelnummer: | A15687 |
| Alternativnummer: | ABB-A15687-100UL,ABB-A15687-20UL,ABB-A15687-1000UL,ABB-A15687-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | DASS, LTBP2, LTBP-3, STHAG6, pp6425, GPHYSD3, LTBP3 |
| The protein encoded by this gene forms a complex with transforming growth factor beta (TGF-beta) proteins and may be involved in their subcellular localization. Activation of this complex requires removal of the encoded binding protein. This protein also may play a structural role in the extracellular matrix. Three transcript variants encoding different isoforms have been found for this gene. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 139kDa |
| NCBI: | 4054 |
| UniProt: | Q9NS15 |
| Reinheit: | Affinity purification |
| Sequenz: | ICKEGKCVNTQPGYECYCKQGFYYDGNLLECVDVDECLDESNCRNGVCENTRGGYRCACTPPAEYSPAQRQCLSPEEMDVDECQDPAACRPGRCVNLPGSYRCECRPPWVPGPSGRDCQLPESPAERAPERRDVCWSQRGEDGMCAGPLAGPALTFDDCCCRQGRGWGAQCRPCPPRGAGSHCPTSQSESNSFWDTSPLLLGKPPRDEDSSEEDSDECRCVSGRCVPRPGGAVCECPGGFQLDASRARCVDIDEC |
| Target-Kategorie: | LTBP3 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Rat. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from Rat uterus, using LTBP3 Rabbit pAb (A15687) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 45s. |
Produktgarantie und fachkundiger Support
