ORC2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A15697
Artikelname: ORC2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A15697
Hersteller Artikelnummer: A15697
Alternativnummer: ABB-A15697-100UL,ABB-A15697-20UL,ABB-A15697-1000UL,ABB-A15697-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: ORC2L, ORC2
The origin recognition complex (ORC) is a highly conserved six subunits protein complex essential for the initiation of the DNA replication in eukaryotic cells. Studies in yeast demonstrated that ORC binds specifically to origins of replication and serves as a platform for the assembly of additional initiation factors such as Cdc6 and Mcm proteins. The protein encoded by this gene is a subunit of the ORC complex. This protein forms a core complex with ORC3, -4, and -5. It also interacts with CDC45 and MCM10, which are proteins known to be important for the initiation of DNA replication. This protein has been demonstrated to specifically associate with the origin of replication of Epstein-Barr virus in human cells, and is thought to be required for DNA replication from viral origin of replication. Alternatively spliced transcript variants have been found, one of which is a nonsense-mediated mRNA decay candidate.
Klonalität: Polyclonal
Molekulargewicht: 66kDa
NCBI: 4999
UniProt: Q13416
Reinheit: Affinity purification
Sequenz: TSYENSLLVKQSGSLPLSSLTHVLRSLTPNARGIFRLLIKYQLDNQDNPSYIGLSFQDFYQQCREAFLVNSDLTLRAQLTEFRDHKLIRTKKGTDGVEYLLIPVDNGTLTDFLEKEEEEA
Target-Kategorie: ORC2
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,Nuclear Receptor Signaling,Cell Biology Developmental Biology,Cell Cycle,Centrosome. Shipping: Ice Bag
Western blot analysis of various lysates using ORC2 Rabbit pAb (A15697) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.