TCHH Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A15731
- Bilder (1)
| Artikelname: | TCHH Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A15731 |
| Hersteller Artikelnummer: | A15731 |
| Alternativnummer: | ABB-A15731-20UL,ABB-A15731-100UL,ABB-A15731-500UL,ABB-A15731-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | THH, THL, TRHY, UHS3, TCHH |
| The protein encoded by this gene forms crosslinked complexes with itself and keratin intermediate filaments to provide mechanical strength to the hair follicle inner root sheath. The encoded protein also is important for structural integrity of the filiform papillae of the tongue. Defects in this gene are a cause of uncombable hair syndrome. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 254kDa |
| NCBI: | 7062 |
| UniProt: | Q07283 |
| Reinheit: | Affinity purification |
| Sequenz: | RARCDGKESLLQDRRQEEDQRRFEPRDRQLEEEPGQRRRQKRQEQERELAEGEEQSEKQERLEQRDRQRRDEELWRQRQEWQEREERRAEEEQLQSCKGHETEEFPDEEQLRRRELLELRRKGREEKQQQRRERQDRVFQEEEEKEWRKRETVLRKEEEKLQEEEPQRQRELQEEEEQLRKLERQELRRERQEEEQQQQRL |
| Target-Kategorie: | TCHH |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cytoskeleton,Intermediate Filaments,Extracellular Matrix,Keratin. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using TCHH Rabbit pAb (A15731) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 60s. |
Produktgarantie und fachkundiger Support
