PPAP2B Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A15743
Artikelname: PPAP2B Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A15743
Hersteller Artikelnummer: A15743
Alternativnummer: ABB-A15743-20UL,ABB-A15743-100UL,ABB-A15743-500UL,ABB-A15743-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: LPP3, VCIP, Dri42, PAP2B, PPAP2B
The protein encoded by this gene is a member of the phosphatidic acid phosphatase (PAP) family. PAPs convert phosphatidic acid to diacylglycerol, and function in de novo synthesis of glycerolipids as well as in receptor-activated signal transduction mediated by phospholipase D. This protein is a membrane glycoprotein localized at the cell plasma membrane. It has been shown to actively hydrolyze extracellular lysophosphatidic acid and short-chain phosphatidic acid. The expression of this gene is found to be enhanced by epidermal growth factor in Hela cells.
Klonalität: Polyclonal
Molekulargewicht: 35kDa
NCBI: 8613
UniProt: O14495
Reinheit: Affinity purification
Sequenz: MQNYKYDKAIVPESKNGGSPALNNNPRRSGSKRVLLICLDLFCLFMAGLPFLIIETSTIKPYHRGFYCNDESIKYPLKTGETINDAVLCAVGIVIAILAI
Target-Kategorie: PLPP3
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. Shipping: Ice Bag
Western blot analysis of various lysates, using PPAP2B Rabbit pAb (A15743) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.