KIF1C Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A15786
- Bilder (1)
| Artikelname: | KIF1C Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A15786 |
| Hersteller Artikelnummer: | A15786 |
| Alternativnummer: | ABB-A15786-100UL,ABB-A15786-20UL,ABB-A15786-1000UL,ABB-A15786-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | SAX2, LTXS1, SATX2, SPAX2, SPG58, KIF1C |
| The protein encoded by this gene is a member of the kinesin-like protein family. The family members are microtubule-dependent molecular motors that transport organelles within cells and move chromosomes during cell division. Mutations in this gene are a cause of spastic ataxia 2, autosomal recessive. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 123kDa |
| NCBI: | 10749 |
| UniProt: | O43896 |
| Reinheit: | Affinity purification |
| Sequenz: | EEGGGAGSGGGSEEGARGAEVEDLRAHIDKLTGILQEVKLQNSSKDRELQALRDRMLRMERVIPLAQDHEDENEEGGEVPWAPPEGSEAAEEAAPSDRMPSARPPSPPLSSWERVSRLMEEDPAFRRGRLRWLKQEQLRLQGLQGSGGRGG |
| Target-Kategorie: | KIF1C |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding,Signal Transduction,Cell Biology Developmental Biology,Cytoskeleton,Motor Proteins,Immunology Inflammation,Cell Intrinsic Innate Immunity Signaling Pathway. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using KIF1C Rabbit pAb (A15786) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 5s. |
Produktgarantie und fachkundiger Support
