TRbeta1/THRB Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A1582
- Bilder (1)
| Artikelname: | TRbeta1/THRB Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A1582 |
| Hersteller Artikelnummer: | A1582 |
| Alternativnummer: | ABB-A1582-20UL,ABB-A1582-100UL,ABB-A1582-1000UL,ABB-A1582-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | TRb, GRTH, PRTH, THR1, ERBA2, NR1A2, THRB1, THRB2, TRbeta, THRbeta, TRbeta1, C-ERBA-2, THRbeta1, Thrbeta2, C-ERBA-BETA, TRbeta1/THRB |
| The protein encoded by this gene is a nuclear hormone receptor for triiodothyronine. It is one of the several receptors for thyroid hormone, and has been shown to mediate the biological activities of thyroid hormone. Knockout studies in mice suggest that the different receptors, while having certain extent of redundancy, may mediate different functions of thyroid hormone. Mutations in this gene are known to be a cause of generalized thyroid hormone resistance (GTHR), a syndrome characterized by goiter and high levels of circulating thyroid hormone (T3-T4), with normal or slightly elevated thyroid stimulating hormone (TSH). Several alternatively spliced transcript variants encoding the same protein have been observed for this gene. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 53kDa |
| NCBI: | 7068 |
| UniProt: | P10828 |
| Reinheit: | Affinity purification |
| Sequenz: | MTPNSMTENGLTAWDKPKHCPDREHDWKLVGMSEACLHRKSHSERRSTLKNEQSSPHLIQTTWTSSIFHLDHDDVNDQSVSSAQTFQTEEKKCKGYIPSYLDKDELCVVCGDKATGYHYRCITCEGCKGFFRRTIQKNLHPSYSCKYEGKCVIDKVTRNQCQECRFKKCIYVGMATDLVLDDSKRLAKRKLIEENREKRRREELQKSIGHKPEPTDEEWELIKTVTEAHVATNAQGSHWKQKRKFLPEDIGQAPI |
| Target-Kategorie: | THRB |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:2000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Signal Transduction,Cell Biology Developmental Biology,Growth factors,Endocrine Metabolism,Neuroscience. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from Mouse pancreas, using TRbeta1/THRB Rabbit pAb (A1582) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 30s. |
Produktgarantie und fachkundiger Support
