ASCC1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A15832
- Bilder (1)
| Artikelname: | ASCC1 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A15832 |
| Hersteller Artikelnummer: | A15832 |
| Alternativnummer: | ABB-A15832-100UL,ABB-A15832-20UL,ABB-A15832-1000UL,ABB-A15832-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | p50, CGI-18, SMABF2, ASC1p50, ASCC1 |
| This gene encodes a subunit of the activating signal cointegrator 1 (ASC-1) complex. The ASC-1 complex is a transcriptional coactivator that plays an important role in gene transactivation by multiple transcription factors including activating protein 1 (AP-1), nuclear factor kappa-B (NF-kB) and serum response factor (SRF). The encoded protein contains an N-terminal KH-type RNA-binding motif which is required for AP-1 transactivation by the ASC-1 complex. Mutations in this gene are associated with Barrett esophagus and esophageal adenocarcinoma. Alternatively spliced transcripts encoding multiple isoforms have been observed for this gene. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 46kDa |
| NCBI: | 51008 |
| UniProt: | Q8N9N2 |
| Reinheit: | Affinity purification |
| Sequenz: | MEVLRPQLIRIDGRNYRKNPVQEQTYQHEEDEEDFYQGSMECADEPCDAYEVEQTPQGFRSTLRAPSLLYKHIVGKRGDTRKKIEMETKTSISIPKPGQDGEIVITGQHRNGVISARTRIDVLLDTFRRKQPFTHFLAFFLNEVEVQEGFLRFQEEVLAKCSMDHGVDSSIFQNPKKLHL |
| Target-Kategorie: | ASCC1 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from rat pancreas, using ASCC1 Rabbit pAb (A15832) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 10s. |
Produktgarantie und fachkundiger Support
