ACTR10 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A15867
Artikelname: ACTR10 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A15867
Hersteller Artikelnummer: A15867
Alternativnummer: ABB-A15867-100UL,ABB-A15867-20UL,ABB-A15867-500UL,ABB-A15867-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: Arp10, Arp11, ACTR11, HARP11, ACTR10
Predicted to be involved in retrograde axonal transport of mitochondrion. Predicted to be located in cytosol, extracellular region, and secretory granule. Predicted to be part of dynactin complex.
Klonalität: Polyclonal
Molekulargewicht: 46kDa
NCBI: 55860
UniProt: Q9NZ32
Reinheit: Affinity purification
Sequenz: SDLKRGLKIQAAKFNIDGNNERPSPPPNVDYPLDGEKILHILGSIRDSVVEILFEQDNEEQSVATLILDSLIQCPIDTRKQLAENLVVIGGTSMLPGFLHRLLAEIRYLVEKPKYKKALGTKTFRIHTPPAKANCVAWLGGAIFGALQDILGSRSVSKEYYNQTGRIPDWCSLNNPPLEMMFDVGKTQPPLMKRAFSTEK
Target-Kategorie: ACTR10
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cell Cycle,Centrosome,Cytoskeleton,Microfilaments. Shipping: Ice Bag
Western blot analysis of various lysates using ACTR10 Rabbit pAb (A15867) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.