ZNF766 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A15925
Artikelname: ZNF766 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A15925
Hersteller Artikelnummer: A15925
Alternativnummer: ABB-A15925-100UL,ABB-A15925-20UL,ABB-A15925-500UL,ABB-A15925-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: ZNF766
Predicted to enable DNA binding activity and metal ion binding activity. Predicted to be involved in regulation of transcription, DNA-templated. Located in nucleus.
Klonalität: Polyclonal
Molekulargewicht: 55kDa
NCBI: 90321
UniProt: Q5HY98
Reinheit: Affinity purification
Sequenz: MMKQRTEPWTVENEMKVAKNPDRWEGIKDINTGRSCAVRSKAGNKPITNQLGLTFQLPLPELEIFQGEGKIYECNQVQKFISHSSSVSPLQRIYSGVKTHIFNKHRNDFVDFPLLSQEQKAHIRRKPYECN
Target-Kategorie: ZNF766
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors. Shipping: Ice Bag
Western blot analysis of various lysates using ZNF766 Rabbit pAb (A15925) at 1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.