MVB12A Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A15933
- Bilder (1)
| Artikelname: | MVB12A Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A15933 |
| Hersteller Artikelnummer: | A15933 |
| Alternativnummer: | ABB-A15933-100UL,ABB-A15933-20UL,ABB-A15933-500UL,ABB-A15933-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CFBP, FAM125A, MVB12A |
| Enables lipid binding activity and ubiquitin binding activity. Involved in regulation of epidermal growth factor receptor signaling pathway, viral budding, and virus maturation. Located in several cellular components, including Golgi apparatus, centrosome, and nucleoplasm. Part of ESCRT I complex. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 29kDa |
| NCBI: | 93343 |
| UniProt: | Q96EY5 |
| Reinheit: | Affinity purification |
| Sequenz: | MDPVPGTDSAPLAGLAWSSASAPPPRGFSAISCTVEGAPASFGKSFAQKSGYFLCLSSLGSLENPQENVVADIQIVVDKSPLPLGFSPVCDPMDSKASVSKKKRMCVKLLPLGATDTAVFDVRLSGKTKTVPGYLRIGDMGGFAIWCKKAKAPRPVPKPRGLSRDMQGLSLDAASQPSKGGLLERTASRLGSRASTLRRNDSIYEASSLYGISAMDGVPFTLHPRFEGKSCSPLAFSAFGDLTIKSLADIEEEYN |
| Target-Kategorie: | MVB12A |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Rat. ResearchArea: Signal Transduction. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from rat pancreas, using MVB12A Rabbit pAb (A15933) at 1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Enhanced Kit (RM00021). Exposure time: 10s. |
Produktgarantie und fachkundiger Support
