RBP7 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A15939
- Bilder (1)
| Artikelname: | RBP7 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A15939 |
| Hersteller Artikelnummer: | A15939 |
| Alternativnummer: | ABB-A15939-100UL,ABB-A15939-20UL,ABB-A15939-500UL,ABB-A15939-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, IF, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CRBP4, CRABP4, CRBPIV, RBP7 |
| The protein encoded by this gene is a member of the cellular retinol-binding protein (CRBP) family, whose members are required for vitamin A stability and metabolism. The encoded protein binds all-trans-retinol and is structurally similar to other CRBPs, however, it has a lower binding affinity for retinol than other CRBPs. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 16kDa |
| NCBI: | 116362 |
| UniProt: | Q96R05 |
| Reinheit: | Affinity purification |
| Sequenz: | MPADLSGTWTLLSSDNFEGYMLALGIDFATRKIAKLLKPQKVIEQNGDSFTIHTNSSLRNYFVKFKVGEEFDEDNRGLDNRKCKSLVIWDNDRLTCIQKGEKKNRGWTHWIEGDKLHLEMFCEGQVCKQTFQRA |
| Target-Kategorie: | RBP7 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Mouse,Rat. ResearchArea: Endocrine Metabolism. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using RBP7 Rabbit pAb (A15939) at 1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s. |
Produktgarantie und fachkundiger Support
