CENPA Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A15995
Artikelname: CENPA Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A15995
Hersteller Artikelnummer: A15995
Alternativnummer: ABB-A15995-20UL,ABB-A15995-100UL,ABB-A15995-1000UL,ABB-A15995-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: CenH3, CENP-A, CENPA
Centromeres are the differentiated chromosomal domains that specify the mitotic behavior of chromosomes. This gene encodes a centromere protein which contains a histone H3 related histone fold domain that is required for targeting to the centromere. Centromere protein A is proposed to be a component of a modified nucleosome or nucleosome-like structure in which it replaces 1 or both copies of conventional histone H3 in the (H3-H4)2 tetrameric core of the nucleosome particle. The protein is a replication-independent histone that is a member of the histone H3 family. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
Klonalität: Polyclonal
Molekulargewicht: 16kDa
NCBI: 1058
UniProt: P49450
Reinheit: Affinity purification
Sequenz: MGPRRRSRKPEAPRRRSPSPTPTPGPSRRGPSLGASSHQHSRRRQGWLKEIRKLQKSTHLLIRKLPFSRLAREICVKFTRGVDFNWQAQALLALQEAAEA
Target-Kategorie: CENPA
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,Protein phosphorylation,Cell Biology Developmental Biology,Cell Cycle. Shipping: Ice Bag
Western blot analysis of various lysates using CENPA Rabbit pAb (A15995) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.