DCT Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A16041
Artikelname: DCT Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A16041
Hersteller Artikelnummer: A16041
Alternativnummer: ABB-A16041-100UL,ABB-A16041-20UL,ABB-A16041-500UL,ABB-A16041-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: OCA8, TRP-2, TYRP2, DCT
Predicted to enable dopachrome isomerase activity. Involved in response to blue light. Located in intracellular membrane-bounded organelle and plasma membrane. Implicated in oculocutaneous albinism.
Klonalität: Polyclonal
Molekulargewicht: 59kDa
NCBI: 1638
UniProt: P40126
Reinheit: Affinity purification
Sequenz: NVCGSQQGRGQCTEVRADTRPWSGPYILRNQDDRELWPRKFFHRTCKCTGNFAGYNCGDCKFGWTGPNCERKKPPVIRQNIHSLSPQEREQFLGALDLAKKRVHPDYVITTQHWLGLLGPNGTQPQFANCSVYDFFVWLHYYSVRDTLLGPGRPYRAIDFSHQGPAFVTWHRYHLLCLERDLQRLIGNESFALPYWNFATGRNECDVCTDQLFGAARPDDPTLISRNSRFSSWETVCDSLDDYNHLVTLCNGTYE
Target-Kategorie: DCT
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. ResearchArea: Cell Biology Developmental Biology,Cell Cycle,Cell differentiation,Endocrine Metabolism. Shipping: Ice Bag
Western blot analysis of various lysates using DCT Rabbit pAb (A16041) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.