GPR32 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A16049
Artikelname: GPR32 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A16049
Hersteller Artikelnummer: A16049
Alternativnummer: ABB-A16049-100UL,ABB-A16049-20UL,ABB-A16049-500UL,ABB-A16049-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: DRV1, RVDR1, GPR32
This gene is intronless and encodes a member of the G-protein coupled receptor 1 family. The encoded protein binds to resolvin D1 and lipoxin A4 and has been linked to pulmonary inflammation. A related pseudogene has been identified on chromosome 19.
Klonalität: Polyclonal
Molekulargewicht: 40kDa
NCBI: 2854
UniProt: O75388
Reinheit: Affinity purification
Sequenz: MNGVSEGTRGCSDRQPGVLTRDRSCSRKMNSSGCLSEEVGSLRPLTVVILSASIVVGVLGNGLVLWMTVFRMARTVSTVCFFHLALADFMLSLSLPIAMY
Target-Kategorie: GPR32
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,G protein signaling,G-Protein-Coupled ReceptorsGPCR. Shipping: Ice Bag
Western blot analysis of lysates from A-549 cells, using GPR32 Rabbit pAb (A16049) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.