LHX1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A16055
Artikelname: LHX1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A16055
Hersteller Artikelnummer: A16055
Alternativnummer: ABB-A16055-1000UL,ABB-A16055-100UL,ABB-A16055-500UL,ABB-A16055-20UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: LIM1, LIM-1, LHX1
This gene encodes a member of a large protein family which contains the LIM domain, a unique cysteine-rich zinc-binding domain. The encoded protein is a transcription factor important for the development of the renal and urogenital systems. This gene is a candidate for Mayer-Rokitansky-Kuster-Hauser syndrome, a disorder characterized by anomalies in the female genital tract.
Klonalität: Polyclonal
Molekulargewicht: 45kDa
NCBI: 3975
UniProt: P48742
Reinheit: Affinity purification
Sequenz: PPSSQAQTPVDLPFVPSSGPSGTPLGGLEHPLPGHHPSSEAQRFTDILAHPPGDSPSPEPSLPGPLHSMSAEVFGPSPPFSSLSVNGGASYGNHLSHPPEMNEAAVW
Target-Kategorie: LHX1
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Cell Biology Developmental Biology,Neuroscience,Stem Cells. Shipping: Ice Bag
Western blot analysis of various lysates using LHX1 Rabbit pAb (A16055) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.