TMC5 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A16144
| Artikelname: |
TMC5 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: |
ABB-A16144 |
| Hersteller Artikelnummer: |
A16144 |
| Alternativnummer: |
ABB-A16144-20UL,ABB-A16144-100UL,ABB-A16144-1000UL,ABB-A16144-500UL |
| Hersteller: |
ABclonal |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
ELISA, WB |
| Spezies Reaktivität: |
Human |
| Immunogen: |
Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
TMC5 |
| Predicted to enable mechanosensitive ion channel activity. Predicted to be involved in ion transmembrane transport. Located in extracellular exosome. |
| Klonalität: |
Polyclonal |
| Molekulargewicht: |
115kDa |
| NCBI: |
79838 |
| UniProt: |
Q6UXY8 |
| Reinheit: |
Affinity purification |
| Sequenz: |
YWQITEGRKIMIRLLHEQIINEGKDKMFLIEKLIKLQDMEKKANPSSLVLERREVEQQGFLHLGEHDGSLDLRSRRSVQEGNPRA |
| Target-Kategorie: |
TMC5 |
| Antibody Type: |
Primary Antibody |
| Application Verdünnung: |
WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: |
Cross-Reactivity: Human. ResearchArea: Cell Biology Developmental Biology. Shipping: Ice Bag |
|
Western blot analysis of lysates from BT-474 cells, using TMC5 Rabbit pAb (A16144) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 10s. |