TMC5 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A16144
Artikelname: TMC5 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A16144
Hersteller Artikelnummer: A16144
Alternativnummer: ABB-A16144-20UL,ABB-A16144-100UL,ABB-A16144-1000UL,ABB-A16144-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: TMC5
Predicted to enable mechanosensitive ion channel activity. Predicted to be involved in ion transmembrane transport. Located in extracellular exosome.
Klonalität: Polyclonal
Molekulargewicht: 115kDa
NCBI: 79838
UniProt: Q6UXY8
Reinheit: Affinity purification
Sequenz: YWQITEGRKIMIRLLHEQIINEGKDKMFLIEKLIKLQDMEKKANPSSLVLERREVEQQGFLHLGEHDGSLDLRSRRSVQEGNPRA
Target-Kategorie: TMC5
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human. ResearchArea: Cell Biology Developmental Biology. Shipping: Ice Bag
Western blot analysis of lysates from BT-474 cells, using TMC5 Rabbit pAb (A16144) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.