CEP290 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A16147
Artikelname: CEP290 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A16147
Hersteller Artikelnummer: A16147
Alternativnummer: ABB-A16147-100UL,ABB-A16147-20UL,ABB-A16147-500UL,ABB-A16147-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: CT87, MKS4, POC3, rd16, BBS14, JBTS5, LCA10, NPHP6, SLSN6, 3H11Ag, CEP290
This gene encodes a protein with 13 putative coiled-coil domains, a region with homology to SMC chromosome segregation ATPases, six KID motifs, three tropomyosin homology domains and an ATP/GTP binding site motif A. The protein is localized to the centrosome and cilia and has sites for N-glycosylation, tyrosine sulfation, phosphorylation, N-myristoylation, and amidation. Mutations in this gene have been associated with Joubert syndrome and nephronophthisis and the presence of antibodies against this protein is associated with several forms of cancer.
Klonalität: Polyclonal
Molekulargewicht: 290kDa
NCBI: 80184
UniProt: O15078
Reinheit: Affinity purification
Sequenz: QKVVDNSVSLSELELANKQYNELTAKYRDILQKDNMLVQRTSNLEHLECENISLKEQVESINKELEITKEKLHTIEQAWEQETKLGNESSMDKAKKSITNS
Target-Kategorie: CEP290
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,Cell Biology Developmental Biology,Cell Cycle,Centrosome,Neuroscience. Shipping: Ice Bag
Western blot analysis of various lysates using CEP290 Rabbit pAb (A16147) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.