MYOCD Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A16159
Artikelname: MYOCD Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A16159
Hersteller Artikelnummer: A16159
Alternativnummer: ABB-A16159-100UL,ABB-A16159-20UL,ABB-A16159-500UL,ABB-A16159-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IHC-P, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: MGBL, MYCD, MYOCD
This gene encodes a nuclear protein, which is expressed in heart, aorta, and in smooth muscle cell-containing tissues. It functions as a transcriptional co-activator of serum response factor (SRF) and modulates expression of cardiac and smooth muscle-specific SRF-target genes, and thus may play a crucial role in cardiogenesis and differentiation of the smooth muscle cell lineage. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Klonalität: Polyclonal
Molekulargewicht: 102kDa
NCBI: 93649
UniProt: Q8IZQ8
Reinheit: Affinity purification
Sequenz: SQVCTAQMAGLHSSDKVGPKFSIPSPTFSKSSSAISEVTQPPSYEDAVKQQMTRSQQMDELLDVLIESGEMPADAREDHSCLQKVPKIPRSSRSPTAVLTK
Target-Kategorie: MYOCD
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|IHC-P,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Cardiovascular,Heart,Cardiogenesis. Shipping: Ice Bag
Immunohistochemistry analysis of paraffin-embedded Rat brain using MYOCD Rabbit pAb (A16159) at dilution of 1:100 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate buffer (pH 6.0) prior to IHC staining.