GSPT1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A16214
- Bilder (1)
| Artikelname: | GSPT1 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A16214 |
| Hersteller Artikelnummer: | A16214 |
| Alternativnummer: | ABB-A16214-100UL,ABB-A16214-20UL,ABB-A16214-500UL,ABB-A16214-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | GST1, ETF3A, eRF3a, 551G9.2, GSPT1 |
| Enables translation release factor activity. Involved in regulation of translational termination. Acts upstream of or within protein methylation. Predicted to be located in cytosol. Predicted to be part of translation release factor complex. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 56kDa |
| NCBI: | 2935 |
| UniProt: | P15170 |
| Reinheit: | Affinity purification |
| Sequenz: | SMELSEPIENGETEMSPEESWEHKEEISEAEPGGGSLGDGRPPEESAHEMMEEEEEIPKPKSVVAPPGAPKKEHVNVVFIGHVDAGKSTIGGQIMYLTGMVDKRTLEKYEREAKEKNRETWYLSWALDTNQEERDKGKTVEVGRAYFETEKKHFTILDAPGHKSFVPNMIGGASQADLAVLVISARKGEFETGFEKGGQTREHAMLAKTAGVKHLIVLINKMDDPTVNWSNERYEECKEKLVPFLKKVGFNPKKD |
| Target-Kategorie: | GSPT1 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,RNA Binding. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates, using GSPT1 Rabbit pAb (A16214) at 1:2000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 60s. |
Produktgarantie und fachkundiger Support
