ID4 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A16229
Artikelname: ID4 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A16229
Hersteller Artikelnummer: A16229
Alternativnummer: ABB-A16229-100UL,ABB-A16229-20UL,ABB-A16229-500UL,ABB-A16229-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: IDB4, bHLHb27, ID4
This gene encodes a member of the inhibitor of DNA binding (ID) protein family. The encoded protein lacks DNA binding ability, and instead regulates gene expression through binding to and inhibiting basic helix-loop-helix transcription factors. This protein has been implicated in the regulation of diverse cellular processes that play a role in development and tumorigenesis.
Klonalität: Polyclonal
Molekulargewicht: 17kDa
NCBI: 3400
UniProt: P47928
Reinheit: Affinity purification
Sequenz: MKAVSPVRPSGRKAPSGCGGGELALRCLAEHGHSLGGSAAAAAAAAAARCKAAEAAADEPALCLQCDMNDCYSRLRRLVPTIPPNKKVSKVEILQHVIDY
Target-Kategorie: ID4
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Stem Cells. Shipping: Ice Bag
Western blot analysis of lysates from mouse kidney, using ID4 Rabbit pAb (A16229) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 180s.