GGPS1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A16233
Artikelname: GGPS1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A16233
Hersteller Artikelnummer: A16233
Alternativnummer: ABB-A16233-100UL,ABB-A16233-20UL,ABB-A16233-1000UL,ABB-A16233-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: GGPPS, MDHLO, GGPPS1, MUDHLOV, GGPS1
This gene is a member of the prenyltransferase family and encodes a protein with geranylgeranyl diphosphate (GGPP) synthase activity. The enzyme catalyzes the synthesis of GGPP from farnesyl diphosphate and isopentenyl diphosphate. GGPP is an important molecule responsible for the C20-prenylation of proteins and for the regulation of a nuclear hormone receptor. Alternate transcriptional splice variants, both protein-coding and non-protein-coding, have been found for this gene.
Klonalität: Polyclonal
Molekulargewicht: 35kDa
NCBI: 9453
UniProt: O95749
Reinheit: Affinity purification
Sequenz: QLFSDYKEDLKPLLNTLGLFFQIRDDYANLHSKEYSENKSFCEDLTEGKFSFPTIHAIWSRPESTQVQNILRQRTENIDIKKYCVHYLEDVGSFEYTRNTLKELEAKAYKQIDARGGNPELVALVKHLSKMFKEENE
Target-Kategorie: GGPS1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Cell Biology Developmental Biology,Endocrine Metabolism,Lipid Metabolism. Shipping: Ice Bag
Western blot analysis of lysates from 293T cells, using GGPS1 Rabbit pAb (A16233) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.