MAP3K11 Rabbit pAb, Polyclonal

Artikelnummer: ABB-A16242
Artikelname: MAP3K11 Rabbit pAb, Polyclonal
Artikelnummer: ABB-A16242
Hersteller Artikelnummer: A16242
Alternativnummer: ABB-A16242-20UL,ABB-A16242-100UL,ABB-A16242-500UL,ABB-A16242-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Alternative Synonym: MLK3, PTK1, SPRK, MLK-3, MEKK11, MAP3K11
The protein encoded by this gene is a member of the serine/threonine kinase family. This kinase contains a SH3 domain and a leucine zipper-basic motif. This kinase preferentially activates MAPK8/JNK kinase, and functions as a positive regulator of JNK signaling pathway. This kinase can directly phosphorylate, and activates IkappaB kinase alpha and beta, and is found to be involved in the transcription activity of NF-kappaB mediated by Rho family GTPases and CDC42.
Klonalität: Polyclonal
Molekulargewicht: 93kDa
NCBI: 4296
UniProt: Q16584
Reinheit: Affinity purification
Sequenz: LVAVKAARQDPDEDISVTAESVRQEARLFAMLAHPNIIALKAVCLEEPNLCLVMEYAAGGPLSRALAGRRVPPHVLVNWAVQIARGMHYLHCEALVPVIHRDLKSNNILLLQPIESDDMEH
Target-Kategorie: MAP3K11
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Mouse. ResearchArea: Signal Transduction,Kinase,Serine threonine kinases,Tyrosine kinases,MAPK-JNK Signaling Pathway,Cell Biology Developmental Biology,Cytoskeleton,Actins,TGF-b-Smad Signaling Pathway,Immunology Inflammation,B Cell Receptor Signaling Pathway. Shipping: Ice Bag
Western blot analysis of lysates from Mouse thymus, using MAP3K11 Rabbit pAb (A16242) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.