LATS2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A16249
Artikelname: LATS2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A16249
Hersteller Artikelnummer: A16249
Alternativnummer: ABB-A16249-100UL,ABB-A16249-20UL,ABB-A16249-1000UL,ABB-A16249-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: KPM, LATS2
This gene encodes a serine/threonine protein kinase belonging to the LATS tumor suppressor family. The protein localizes to centrosomes during interphase, and early and late metaphase. It interacts with the centrosomal proteins aurora-A and ajuba and is required for accumulation of gamma-tubulin and spindle formation at the onset of mitosis. It also interacts with a negative regulator of p53 and may function in a positive feedback loop with p53 that responds to cytoskeleton damage. Additionally, it can function as a co-repressor of androgen-responsive gene expression.
Klonalität: Polyclonal
Molekulargewicht: 120kDa
NCBI: 26524
UniProt: Q9NRM7
Reinheit: Affinity purification
Sequenz: FGPYQKALREIRYSLLPFANESGTSAAAEVNRQMLQELVNAGCDQEMAGRALKQTGSRSIEAALEYISKMGYLDPR
Target-Kategorie: LATS2
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,DNA Damage Repair,Signal Transduction,Kinase,Serine threonine kinases,Cell Biology Developmental Biology. Shipping: Ice Bag
Western blot analysis of various lysates using LATS2 Rabbit pAb (A16249) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.