IL1beta Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A16288
Artikelname: IL1beta Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A16288
Hersteller Artikelnummer: A16288
Alternativnummer: ABB-A16288-20UL,ABB-A16288-1000UL,ABB-A16288-100UL,ABB-A16288-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: IL-1, IL1F2, IL1beta, IL1-BETA, IL1beta
The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1 (CASP1/ICE). This cytokine is an important mediator of the inflammatory response, and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis. The induction of cyclooxygenase-2 (PTGS2/COX2) by this cytokine in the central nervous system (CNS) is found to contribute to inflammatory pain hypersensitivity. Similarly, IL-1B has been implicated in human osteoarthritis pathogenesis. Patients with severe Coronavirus Disease 2019 (COVID-19) present elevated levels of pro-inflammatory cytokines such as IL-1B in bronchial alveolar lavage fluid samples. The lung damage induced by the Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) is to a large extent, a result of the inflammatory response promoted by cytokines such as IL-1B. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2.
Klonalität: Polyclonal
Molekulargewicht: 31kDa
NCBI: 3553
UniProt: P01584
Reinheit: Affinity purification
Sequenz: AMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESND
Target-Kategorie: IL1B
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. ResearchArea: Cell Biology Developmental Biology,Apoptosis,Growth factors,Endocrine Metabolism,Endocrine and metabolic diseases,Obesity,Immunology Inflammation,Cytokines,Interleukins,NF-kB Signaling Pathway,Cell Intrinsic Innate Immunity Signaling Pathway,Neuroscience,Neurodegenerative Diseases,Cardiovascular. Shipping: Ice Bag
Western blot analysis of lysates from THP-1 cells, using IL1beta Rabbit pAb (A16288) at 1:1000 dilution. THP-1 cells were treated with LPS (1 µg/ml) at 37°C for 8 hours.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.