VDAC2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A16294
- Bilder (1)
| Artikelname: | VDAC2 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A16294 |
| Hersteller Artikelnummer: | A16294 |
| Alternativnummer: | ABB-A16294-100UL,ABB-A16294-20UL,ABB-A16294-500UL,ABB-A16294-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | POR, VDAC2 |
| This gene encodes a member of the voltage-dependent anion channel pore-forming family of proteins that are considered the main pathway for metabolite diffusion across the mitochondrial outer membrane. The encoded protein is also thought to be involved in the mitochondrial apoptotic pathway via regulation of BCL2-antagonist/killer 1 protein activity. Pseudogenes have been identified on chromosomes 1, 2, 12 and 21, and alternative splicing results in multiple transcript variants. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 32kDa |
| NCBI: | 7417 |
| UniProt: | P45880 |
| Reinheit: | Affinity purification |
| Sequenz: | MSWCNELRLPALKQHSIGRGLESHITMCIPPSYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGVEFSTSGSSNTDTGKVTGTLETKYKWCEYGLTFTEKWNTDNTLGTEIAIEDQICQGLKLTFDTTFSPNTGKKSGKIKSSYKRECINLGCDVDFDFAGPAIHGSAVFGYEGWLAGYQMTFDSAKSKLTRNNFAVGYRTGDFQLHTNVNDGTEFGGSIYQKVCEDLDTSVNLAWTSGTNCTRFGIAAKYQLDP |
| Target-Kategorie: | VDAC2 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism,Mitochondrial metabolism,Mitochondrial markers,Warburg Effect,Neuroscience,Neurodegenerative Diseases. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using VDAC2 Rabbit pAb (A16294) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 60s. |
Produktgarantie und fachkundiger Support
