SRA1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A16296
Artikelname: SRA1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A16296
Hersteller Artikelnummer: A16296
Alternativnummer: ABB-A16296-20UL,ABB-A16296-100UL,ABB-A16296-1000UL,ABB-A16296-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: SRA, SRAP, STRAA1, pp7684, SRA1
Both long non-coding and protein-coding RNAs are transcribed from this gene, and they represent alternatively spliced transcript variants. This gene was initially defined as a non-coding RNA, which is a coactivator for several nuclear receptors (NRs) and is associated with breast cancer. It has now been found that this gene is involved in the regulation of many NR and non-NR activities, including metabolism, adipogenesis and chromatin organization. The long non-coding RNA transcripts interact with a variety of proteins, including the protein encoded by this gene. The encoded protein acts as a transcriptional repressor by binding to the non-coding RNA.
Klonalität: Polyclonal
Molekulargewicht: 24kDa
NCBI: 10011
UniProt: Q9HD15
Reinheit: Affinity purification
Sequenz: MTRCPAGQAEVEMAELYVKPGNKERGWNDPPQFSYGLQTQAGGPRRSLLTKRVAAPQDGSPRVPASETSPGPPPMGPPPPSSKAPRSPPVGSGPASGVEP
Target-Kategorie: SRA1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Rat. ResearchArea: Epigenetics Nuclear Signaling,Nuclear Receptor Signaling,Nuclear hormone receptors,Cancer,Tumor biomarkers,Signal Transduction,Cell Biology Developmental Biology,Apoptosis,Endocrine Metabolism,Lipid Metabolism,Cholesterol Metabolism,Cardiovascular,Lipids. Shipping: Ice Bag
Western blot analysis of various lysates, using SRA1 Rabbit pAb (A16296) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.