USP22 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A16297
Artikelname: USP22 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A16297
Hersteller Artikelnummer: A16297
Alternativnummer: ABB-A16297-100UL,ABB-A16297-20UL,ABB-A16297-500UL,ABB-A16297-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: USP3L, USP22
Enables enzyme binding activity, nuclear receptor coactivator activity, and thiol-dependent deubiquitinase. Contributes to H4 histone acetyltransferase activity. Involved in positive regulation of mitotic cell cycle, positive regulation of transcription, DNA-templated, and protein modification by small protein conjugation or removal. Part of SAGA complex.
Klonalität: Polyclonal
Molekulargewicht: 60kDa
NCBI: 23326
UniProt: Q9UPT9
Reinheit: Affinity purification
Sequenz: TAEARKRKAKSCICHVCGVHLNRLHSCLYCVFFGCFTKKHIHEHAKAKRHNLAIDLMYGGIYCFLCQDYIYDKDMEIIAKEEQRKAWKMQGVGEKFSTWEP
Target-Kategorie: USP22
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Rat. ResearchArea: Epigenetics Nuclear Signaling,Cell Biology Developmental Biology,Ubiquitin. Shipping: Ice Bag
Western blot analysis of various lysates using USP22 Rabbit pAb (A16297) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.