BDNF Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A16299
- Bilder (1)
| Artikelname: | BDNF Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A16299 |
| Hersteller Artikelnummer: | A16299 |
| Alternativnummer: | ABB-A16299-20UL,ABB-A16299-100UL,ABB-A16299-1000UL,ABB-A16299-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | ANON2, BULN2, BDNF |
| This gene encodes a member of the nerve growth factor family of proteins. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate the mature protein. Binding of this protein to its cognate receptor promotes neuronal survival in the adult brain. Expression of this gene is reduced in Alzheimers, Parkinsons, and Huntingtons disease patients. This gene may play a role in the regulation of the stress response and in the biology of mood disorders. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 28kDa |
| NCBI: | 627 |
| UniProt: | P23560 |
| Reinheit: | Affinity purification |
| Sequenz: | PMKEANIRGQGGLAYPGVRTHGTLESVNGPKAGSRGLTSLADTFEHVIEELLDEDQKVRPNEENNKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR |
| Target-Kategorie: | BDNF |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology Developmental Biology,Apoptosis,Growth factors,Endocrine Metabolism,Endocrine and metabolic diseases,Diabetes,Obesity,Neuroscience,Neurodegenerative Diseases,Amyloid Plaque and Neurofibrillary Tangle Formation in Alzheimers Disease,Cardiovascular. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using BDNF Rabbit pAb (A16299) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 180s. |
Produktgarantie und fachkundiger Support
