AP1B1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A16304
Artikelname: AP1B1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A16304
Hersteller Artikelnummer: A16304
Alternativnummer: ABB-A16304-20UL,ABB-A16304-100UL,ABB-A16304-500UL,ABB-A16304-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: ADTB1, BAM22, KIDAR, AP105A, CLAPB2, AP1B1
Adaptor protein complex 1 is found at the cytoplasmic face of coated vesicles located at the Golgi complex, where it mediates both the recruitment of clathrin to the membrane and the recognition of sorting signals within the cytosolic tails of transmembrane receptors. This complex is a heterotetramer composed of two large, one medium, and one small adaptin subunit. The protein encoded by this gene serves as one of the large subunits of this complex and is a member of the adaptin protein family. This gene is a candidate meningioma gene. Alternative splicing results in multiple transcript variants.
Klonalität: Polyclonal
Molekulargewicht: 105kDa
NCBI: 162
UniProt: Q10567
Reinheit: Affinity purification
Sequenz: SDLFDLTSGVGTLSGSYVAPKAVWLPAMKAKGLEISGTFTRQVGSISMDLQLTNKALQVMTDFAIQFNRNSFGLAPAAPLQVHAPLSPNQTVEISLPLSTV
Target-Kategorie: AP1B1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. Shipping: Ice Bag
Western blot analysis of various lysates using AP1B1 Rabbit pAb (A16304) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5min.